SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167BV76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167BV76
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily MbtH-like 2.09e-28
Family MbtH-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A167BV76
Sequence length 70
Comment (tr|A0A167BV76|A0A167BV76_9GAMM) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:KZN46935.1} KW=Complete proteome OX=1365253 OS=Pseudoalteromonas luteoviolacea NCIMB 1942. GN=N482_11015 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MSFDNENGTFKVIINHEEQYSLWPSYKSVPGGWQDTGVSGDKATCLEHIKTHWTDMRPLS
LRNAMAQQDV
Download sequence
Identical sequences A0A167BV76
WP_063377318.1.48189 WP_063377318.1.91553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]