SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167FJL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167FJL4
Domain Number 1 Region: 50-136
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.1e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.00000536
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.88e-16
Family TATA-box binding protein (TBP), C-terminal domain 0.0000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A167FJL4
Sequence length 137
Comment (tr|A0A167FJL4|A0A167FJL4_9ASCO) TATA-binding protein {ECO:0000313|EMBL:ANB15385.1} KW=Complete proteome; Reference proteome OX=796027 OS=Sugiyamaella lignohabitans. GN=AWJ20_3012 OC=Saccharomycetes; Saccharomycetales; Trichomonascaceae; Sugiyamaella.
Sequence
MRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFDAKFTDFKIQNIVGS
CDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEI
YAAFEAIYPVLSEFRKA
Download sequence
Identical sequences A0A167FJL4
XP_018737862.1.655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]