SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167TCD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167TCD5
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily MAL13P1.257-like 4.58e-56
Family MAL13P1.257-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A167TCD5
Sequence length 159
Comment (tr|A0A167TCD5|A0A167TCD5_PENCH) UPF0587 protein {ECO:0000313|EMBL:KZN88120.1} KW=Complete proteome OX=5076 OS=Penicillium chrysogenum (Penicillium notatum). GN=EN45_066910 OC=Penicillium chrysogenum species complex.
Sequence
MLTLSVEAQLEGVTALLPTDTEENPYFYTFRVQCTSCHETHPNWVSFNRFEVHEIPGSRG
EANFVWKCRLCTKTHTASITSGPKPYEAQEKQGAQKIIEMDCRGLEFIEFKPDGEWEAKA
IDSTTTFSGIDLSEGEWYDYDEKKGEEVSIKEITWTVGR
Download sequence
Identical sequences A0A167TCD5 B6HKP6
jgi|Pench1|22115|fgenesh1_pg.1_#_2059 500485.B6HKP6 Pchr_Wisconsin_54-1255:Pc21g02980.t1 XP_002567362.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]