SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167TMN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167TMN4
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 9.68e-17
Family AN1-like Zinc finger 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A167TMN4
Sequence length 72
Comment (tr|A0A167TMN4|A0A167TMN4_9HYPO) Zinc finger, AN1-type {ECO:0000313|EMBL:OAA60757.1} KW=Complete proteome; Reference proteome OX=1081104 OS=Isaria fumosorosea ARSEF 2679. GN=ISF_05796 OC=Isaria.
Sequence
MAPKKIRCNAKDCREAAQRIVGDCGFCNGHFCGKHRLLEDHKCSGLEDCKKQSHERNAAQ
LESERTQVIRGV
Download sequence
Identical sequences A0A0A2VG95 A0A167KUK8 A0A167TMN4 J5JRU3
XP_008599106.1.71110 XP_018703428.1.99123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]