SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167UPJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167UPJ7
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily Pre-PUA domain 8.5e-29
Family Nip7p homolog, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 1.05e-21
Family PUA domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A167UPJ7
Sequence length 184
Comment (tr|A0A167UPJ7|A0A167UPJ7_PENCH) 60S ribosome subunit biogenesis protein NIP7 {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome OX=5076 OS=Penicillium chrysogenum (Penicillium notatum). GN=EN45_080910 OC=Penicillium chrysogenum species complex.
Sequence
MRSLTEEETRTLFTKLASYTGRSLNSLITPAEDGSQSVFRLQGCRVYYVNKDIANLSVSF
PRDQLLSAGTMVGKFTKTGKFRINLTALDLLAQNARYKVWIKANGVMPLLYGGSVLKAHV
ARFSEDCPENAGVVILDSNDVPLGFGVTARSSAQIAKLDPTSIAVHRQADAGEYLREEDT
LFTT
Download sequence
Identical sequences A0A167UPJ7 A0A1V6T8R4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]