SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168HZ79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168HZ79
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily MbtH-like 3.53e-28
Family MbtH-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A168HZ79
Sequence length 72
Comment (tr|A0A168HZ79|A0A168HZ79_9BACL) Protein mbtH {ECO:0000313|EMBL:OAB38688.1} KW=Complete proteome OX=467974 OS=Paenibacillus macquariensis subsp. defensor. GN=PMSD_06645 OC=Paenibacillus.
Sequence
MTNPFDREDVTYLVLMNDEKQYSLWPSYIIVPEGWSVVVEHQSREVCLAFINTQWTDMRP
RSLQPTVKSMNL
Download sequence
Identical sequences A0A168HZ79
WP_068594860.1.93026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]