SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168KG75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168KG75
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 3.92e-28
Family RNA polymerase subunit RPB10 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A168KG75
Sequence length 79
Comment (tr|A0A168KG75|A0A168KG75_CORDF) DNA-directed RNA polymerases I/II/III subunit 10 {ECO:0000313|EMBL:OAA81650.1} KW=Complete proteome; Reference proteome OX=1081108 OS=Cordyceps confragosa RCEF 1005. GN=LEL_01195 OC=Cordyceps.
Sequence
MIIPIRCFSCGKVTGDLWERYLQLIADPKKTDGDAMDELGLKRYCCRRMIMTHVDLIEKL
LKYTPDGRSEIKQKLNEMA
Download sequence
Identical sequences A0A168KG75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]