SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168L6I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168L6I2
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.57e-34
Family Thiamin pyrophosphokinase, catalytic domain 0.00079
Further Details:      
 
Domain Number 2 Region: 146-210
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000128
Family Thiamin pyrophosphokinase, substrate-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A168L6I2
Sequence length 211
Comment (tr|A0A168L6I2|A0A168L6I2_9CLOT) Thiamine pyrophosphokinase {ECO:0000313|EMBL:OAA82729.1} KW=Complete proteome OX=1538 OS=Clostridium ljungdahlii. GN=WY13_04077 OC=Clostridium.
Sequence
MKAIIVSGGSAPSRKLIEKEIDEDSILICADGGANCLYEYKIIPDYLIGDFDSIDKDVLT
FFKSKKCSIDTYPRAKDFTDTEIAVEKSLALKADQIVMLACTGTRIDHVLANLGMLLKCN
RSGVKAYIKDEHNTIELLCKTTTIKGYPGETFSLHAYCNVVKNLNIIGARYKLSNYDLAL
GDARTVSNEFIQEEARIVFDSGMLLCMHSKD
Download sequence
Identical sequences A0A168L6I2
WP_063557283.1.48490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]