SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168MXM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168MXM2
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.09e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000979
Further Details:      
 
Domain Number 2 Region: 79-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.27e-19
Family Cold shock DNA-binding domain-like 0.0000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A168MXM2
Sequence length 171
Comment (tr|A0A168MXM2|A0A168MXM2_MUCCL) Uncharacterized protein {ECO:0000313|EMBL:OAD05503.1} KW=Complete proteome; Reference proteome OX=747725 OS=Mucor circinelloides f. lusitanicus CBS 277.49. GN=MUCCIDRAFT_152689 OC=Mucoraceae; Mucor.
Sequence
MFFLKELTHTISLHPSYFGPNMQGQLKDKLYADVEGTCTGRYGYVITVLSLNNIGKGKIL
PGSGLAEFKVNYQAIVFKPYKGEVLDAIVTTVNKMGFFADVGPLQVFVSNHLIPTDMRFD
ANGNPPCYSSEDQVIQKDVQVRLKLVGTRVDATEIFAIGTIKEDYLGVISS
Download sequence
Identical sequences A0A168MXM2 S2JTS6
jgi|Mucci1|48415|estExt_Genewise1Plus.C_31798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]