SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A169DZX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A169DZX6
Domain Number - Region: 38-62
Classification Level Classification E-value
Superfamily Defensin-like 0.0214
Family Defensin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A169DZX6
Sequence length 79
Comment (tr|A0A169DZX6|A0A169DZX6_BACTI) Uncharacterized protein {ECO:0000313|EMBL:AND28085.1} OX=1430 OS=Bacillus thuringiensis subsp. israelensis. GN=ATN07_30730 OC=Bacillus cereus group.
Sequence
MICKEIDCHSKVRAKGYCAKHYTQIQRHGRVTPEKEKLQNGGICKIEGCNQKLRSRGLCS
SHYYQHMGFYQMKKNKENS
Download sequence
Identical sequences A0A0B5NLL8 A0A0Q9FX74 A0A0Q9G1E8 A0A169DZX6 A0A242YLJ1 A0A2C9Z417 Q3EN08
WP_000562885.1.100059 WP_000562885.1.101838 WP_000562885.1.23615 WP_000562885.1.26459 WP_000562885.1.38325 WP_000562885.1.42217 WP_000562885.1.44348 WP_000562885.1.52284 WP_000562885.1.60526 WP_000562885.1.87705 WP_000562885.1.97830 gi|434380045|ref|YP_006624480.1| gi|434380045|ref|YP_006624480.1|NC_018516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]