SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A169FXX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A169FXX8
Domain Number - Region: 14-90
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0589
Family Fibrinogen coiled-coil and central regions 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A169FXX8
Sequence length 92
Comment (tr|A0A169FXX8|A0A169FXX8_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AND41831.1} KW=Complete proteome OX=1196031 OS=Bacillus oceanisediminis 2691. GN=A361_22580 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MPLGHQDQLNLLKDILSNHQTDCCGSISECEQLERLVKSLMINGNINQNVKTVLEEIYEY
SQHGINSSQLDTHIESHQNELSQWVQDIDQFS
Download sequence
Identical sequences A0A169FXX8 A0A1S1YMD8 E5WJK5
WP_009333350.1.59445 WP_009333350.1.65381 WP_009333350.1.8709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]