SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A172X928 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A172X928
Domain Number 1 Region: 23-154
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 1.73e-24
Family Peptidyl-tRNA hydrolase II 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A172X928
Sequence length 154
Comment (tr|A0A172X928|A0A172X928_9MICO) Uncharacterized protein {ECO:0000313|EMBL:ANF33057.1} KW=Complete proteome; Reference proteome OX=1575 OS=Leifsonia xyli. GN=A0130_16565 OC=Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Leifsonia.
Sequence
MHDIVGFLPEEIDTGAPTRAARLKWVLIVDGSLPAGIAANAAVCTAAATAVRVSGLLGQD
AVDAEDGVHPGLPWAGVSVLRASAEQLVGIRAKAQAAEDVFVADMPAAAQLTRVYDEYLR
TVEAAASADLPYYAVSVVGPRNRVDRIVGRLALL
Download sequence
Identical sequences A0A172X928
WP_064111344.1.62214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]