SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173M1W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173M1W9
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.27e-29
Family Mitochondrial carrier 0.0047
Further Details:      
 
Domain Number 2 Region: 340-432
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.31e-24
Family Interleukin 17F, IL-17F 0.0025
Further Details:      
 
Domain Number 3 Region: 125-166
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173M1W9
Sequence length 433
Comment (tr|A0A173M1W9|A0A173M1W9_CYPCA) Interleukin 17B {ECO:0000313|EMBL:BAV01252.1} OX=7962 OS=Cyprinus carpio (Common carp). GN= OC=Cyprinidae; Cyprinus.
Sequence
MSKQPQPISPLKNFFAGGFGGVCLVFAGHPLDTIKVRLQTQPKPRPGESALYRGTLDCFK
KTLAKEVKYAGPMDCVKQLYRENGVRGIYKGTALTLMRDVPASGMYFMTYEWLKYTLTPE
GKRMSVEVPAGLSELLKGYTLEVLKRRPADLLEFSVQYFTLLREQRSSTRASSSRSPVTR
GVAFDQDSAPTDSSEEEEEEQRQEEEDEEEKEEEQRQEDDEEEEEEDDFPDDFTFKVMSG
SMNVFMVLMVGNLFVPTDTNYTSREGKSRRRKLESQTRRNASSVRISPDPMMTGPESGVM
PGAVEIDFDKSIEDMVSQVRNNPNLSINKCVVDRKLWMSNSRSLSPWSYRINHDEDRKPV
DIPEAVCSCVGCINPFTMQEDRTMTSALIYAKIPVRRVLCHRPTRKPTKNKKCVPRYRSV
VESIAVGCTCIVG
Download sequence
Identical sequences A0A173M1W9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]