SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173YMH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173YMH8
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000314
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173YMH8
Sequence length 139
Comment (tr|A0A173YMH8|A0A173YMH8_CLOVE) NfeD-like C-terminal, partner-binding {ECO:0000313|EMBL:CUN64517.1} KW=Complete proteome; Reference proteome OX=1267 OS=Clostridium ventriculi (Sarcina ventriculi). GN=ERS852473_00729 OC=Clostridium.
Sequence
MIWAWLLVVVIGVLIDLFNSSFLFVGFSIGALGALIINVFKLPILLQFVVFAVVSSLFFI
FIFPKVRKNIKESHLGTNTMEQNYIGKAFILPKRIENTALIKYEGIFWTFKSESGVIEEG
ERVKIIGIEGNKLLIIKDK
Download sequence
Identical sequences A0A173YMH8
WP_055257737.1.29914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]