SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173YQ41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A173YQ41
Domain Number - Region: 73-117
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0115
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173YQ41
Sequence length 292
Comment (tr|A0A173YQ41|A0A173YQ41_9FIRM) Cell shape protein MreC {ECO:0000256|PIRNR:PIRNR038471} KW=Complete proteome OX=88431 OS=Dorea longicatena. GN=ERS852408_00718 OC=Dorea.
Sequence
MKTKNQSSLPSKYWLIIVIVICVILMGVERITGGNGPISFIANYTVIPMQKGIGYVGRYM
SDLSDNFETLQDMKKENKKLQSKVDDLTIDNTRLRQDQYELERLRELYKLDENYSDYKKI
GAHVISNSGSNWFSDFTIDKGSKDGIKKNCNVLAGSGLVGIVTEVGPHYARVRSIIDDES
NISAMLLSTSDTCVVRGDLKQMENGRIRFEKLANNDNKIEVGEQVVTSHVSDRFLQGLFI
GYVSDVKVDSNNLTRSGYITPAVDFSKLQEVLVITTTKSELIKQESGSTKGE
Download sequence
Identical sequences A0A173YQ41 R7FWS7
WP_022416118.1.38214 WP_022416118.1.39282 WP_022416118.1.6856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]