SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174IP09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174IP09
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily BH3703-like 6.02e-16
Family BH3703-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A174IP09
Sequence length 123
Comment (tr|A0A174IP09|A0A174IP09_9FIRM) Protein of uncharacterized function, DUF600 {ECO:0000313|EMBL:CUO88181.1} KW=Complete proteome OX=39488 OS=[Eubacterium] hallii. GN=ERS852450_02594 OC=Eubacterium.
Sequence
MNLDFQDIFNELLNILPSGWENAIFMAEYTSGSYSMRCYSKESNNNYINVMKMKGISKPQ
VIKTYKALNDIFQKERMELVESSWYAITLKFDKNGKFSSDFDYNSHEENVLEYLEQWEQK
NVL
Download sequence
Identical sequences A0A174IP09 A0A1C5UCJ1
WP_055299542.1.34897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]