SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174KCQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174KCQ6
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.0000000017
Family Cell division protein ZapA-like 0.01
Further Details:      
 
Weak hits

Sequence:  A0A174KCQ6
Domain Number - Region: 79-133
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0484
Family PspA lactotransferrin-binding region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A174KCQ6
Sequence length 135
Comment (tr|A0A174KCQ6|A0A174KCQ6_9FIRM) Cell division protein ZapA {ECO:0000256|SAAS:SAAS00072473} KW=Complete proteome OX=40520 OS=Blautia obeum. GN=ERS852394_01984 OC=Blautia.
Sequence
MAVKNTAQVVIGGKIITLGGYESEEYFQKVASYINNKIAELSEMPGYTRQPVETKHTLLS
LNVTDDYFKAKKQAEIFEQDLQQKDQEMYELKHELIALRMKIEETEKNAQEAQQQKELLE
GKVKELNDEIDKLLK
Download sequence
Identical sequences A0A174KCQ6 A0A1C5NAU4 R7DB52
WP_022389301.1.1389 WP_022389301.1.33025 WP_022389301.1.68142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]