SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174PKN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A174PKN3
Domain Number - Region: 38-95
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0144
Family RecG, N-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 87-166
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0345
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A174PKN3
Sequence length 177
Comment (tr|A0A174PKN3|A0A174PKN3_BACVU) Putative anti-restriction protein {ECO:0000313|EMBL:CUP59360.1} KW=Complete proteome OX=821 OS=Bacteroides vulgatus. GN=ERS852509_02524 OC=Bacteroides.
Sequence
MEAKVLSEAKVYVGTYAKYNNGSLSGAWLDLSDYSDKEEFYEACRELHKDEEDAEYMFQD
WENVPEGLIGESWISENFFALRDAVEDLSDTEQEAFFVWCNYKSHDLGEEDADDLVRDFR
DEYLGQYDDEEDFAYEIIEECYDLPEFAKTYFDYEKFARDLFMCDYWFDDGFVFRAA
Download sequence
Identical sequences A0A078PWN4 A0A078Q3S4 A0A0E2SX27 A0A0F5JA33 A0A174PKN3 C9KY31
WP_007754113.1.10024 WP_007754113.1.30930 WP_007754113.1.34635 WP_007754113.1.39779 WP_007754113.1.41584 WP_007754113.1.49999 WP_007754113.1.58888 WP_007754113.1.67423 WP_007754113.1.74405 WP_007754113.1.76253 WP_007754113.1.77561 WP_007754113.1.97168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]