SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174QAK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A174QAK3
Domain Number - Region: 5-40
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0196
Family DNA polymerase beta-like, second domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A174QAK3
Sequence length 69
Comment (tr|A0A174QAK3|A0A174QAK3_9BACE) Uncharacterized protein {ECO:0000313|EMBL:CUP68806.1} KW=Complete proteome OX=47678 OS=Bacteroides caccae. GN=ERS852494_02842 OC=Bacteroides.
Sequence
MARNIIDLICNSCSCGKEEAQEYLDDEIRNLQELQADNDLRGEDFEIACSNLGLDQDWQI
YFINRLAGL
Download sequence
Identical sequences A0A0P0GCH0 A0A174QAK3 A0A174RX37 A0A174U423 A0A1Y4FFB1 R7JRC0
WP_022460391.1.32410 WP_022460391.1.39634 WP_022460391.1.43461 WP_022460391.1.52087 WP_022460391.1.60264 WP_022460391.1.90191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]