SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A174YJ38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174YJ38
Domain Number 1 Region: 9-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000385
Family Tetracyclin repressor-like, N-terminal domain 0.0078
Further Details:      
 
Weak hits

Sequence:  A0A174YJ38
Domain Number - Region: 88-191
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A174YJ38
Sequence length 207
Comment (tr|A0A174YJ38|A0A174YJ38_9FIRM) DNA-binding transcriptional repressor AcrR {ECO:0000313|EMBL:CUQ75133.1} KW=Complete proteome OX=39485 OS=[Eubacterium] eligens. GN=ERS852490_00339 OC=Eubacterium.
Sequence
MSKAVEGVTEKIEEYARKEFKSKGYVDASLRTIAMEAGTTTGSIYSRYGGKEGLFSALVE
PAAREFTEIFEDVQKKFHAMESEMQTESLDEYSRNGMIQLVEYMYNHFEEFNLLVNCSYG
TKFQNFVEHLVDIETDYTYKYMEAVGLKFKEGRPLTKDFMHIMNTALFESFFEVVRHNMS
KEEAMEYIDLLEKYHSAGWSVIYDECK
Download sequence
Identical sequences A0A174YJ38 R6ABV3
WP_022098109.1.40640 WP_022098109.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]