SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175JYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JYZ0
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.83e-21
Family Nucleolar RNA-binding protein Nop10-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175JYZ0
Sequence length 59
Comment (tr|A0A175JYZ0|A0A175JYZ0_ENTHI) Ribosome biogenesis protein nop10 putative {ECO:0000313|EMBL:GAT98544.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_131470 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MLLYYCDNCKQYTMKTECPQCNGYVRSAHPAKFSPVDPYSKYRIATKKEFGLLPTSTKN
Download sequence
Identical sequences A0A175JYZ0 C4M9Y2 M2Q9Z0 M7W3Q3 N9UNJ5
gi|56471997|gb|EAL49521.1| gi|67479055|ref|XP_654909.1| jCVI|EHI_131470 XP_654909.1.49425 294381.C4M9Y2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]