SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A175VE75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175VE75
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily YfbU-like 9.55e-54
Family YfbU-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175VE75
Sequence length 166
Comment (tr|A0A175VE75|A0A175VE75_AEREN) Uncharacterized protein {ECO:0000313|EMBL:KXU78965.1} KW=Complete proteome OX=29489 OS=Aeromonas enteropelogenes (Aeromonas trota). GN=LCR_01400 OC=Aeromonadaceae; Aeromonas.
Sequence
MNISNAERLILSNQYEILAKLNPEKAAFYQRASTIIERGYCLQLLELEKHFGHLDQATCQ
EVIDTLELHHALAISWGNLEAAEQAEIAASRLEFNGYSRSQERELADYVCFLLEVDKRFP
ELKCPCDELSSDIAMRGKYQRMLVEWHQCPRQYKLSIQEIRKVLAA
Download sequence
Identical sequences A0A175VE75
WP_026455879.1.55242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]