SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A176EG40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A176EG40
Domain Number 1 Region: 39-88
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000000654
Family PsbU-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A176EG40
Sequence length 169
Comment (tr|A0A176EG40|A0A176EG40_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KZY10136.1} KW=Complete proteome OX=1822227 OS=Erythrobacter sp. HI0028. GN=A3723_08035 OC=Erythrobacteraceae; Erythrobacter.
Sequence
MRKLVLASALSGAVLSLAACSGAADETAETTDTAEVETIDDAAAAETAAVLDANTATAEQ
LAALDGVSDELAAAIVAGQPYASVTDLNAALLETLGEDEAAQVLVDVFVPVNLNSGTEEE
IRLIPGMTDKMVHEFEEYRPYADMGVFDREIGKYVDEAEVERFKNYVTL
Download sequence
Identical sequences A0A176EG40
WP_063512478.1.39917 WP_063512478.1.90456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]