SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A176NHA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A176NHA0
Domain Number 1 Region: 36-260
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 7.59e-60
Family Chemotaxis phosphatase CheZ 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A176NHA0
Sequence length 261
Comment (tr|A0A176NHA0|A0A176NHA0_9PSED) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=86265 OS=Pseudomonas thivervalensis. GN=APS14_08780 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDNESSMGDFESTLKKHARELVDSLEKGRFGDAVQMIHELNQTRDRGLYQEVGKLTRELH
SAIVNFQIDPHMPQAEEVSQITDATERLGYVVKLTEAAANRTMDLVESATPLVNGLSEEA
QALSSDWGRFMRREVGAEEFRELARRVDGFLTRSSNENRAVASNLNDILLAQDYQDLTGQ
VIKRVTQLVTEVESNLLKLVLMASQVDRFAGIEHDREAMLAEKDPQKHLSQGEGPQIHAD
KREDVMSGQDDVDDLLSSLGF
Download sequence
Identical sequences A0A176NHA0
WP_053120301.1.11011 WP_053120301.1.17350 WP_053120301.1.43403 WP_053120301.1.56633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]