SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A176UY41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A176UY41
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 6.8e-27
Family PA0094-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A176UY41
Sequence length 146
Comment (tr|A0A176UY41|A0A176UY41_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OAE09017.1} KW=Complete proteome OX=1835724 OS=Pantoea sp. OXWO6B1. GN=A6A26_15975 OC=Erwiniaceae; Pantoea.
Sequence
MNYQFNEGAFALFPAAWQDTTMNILRDDASGLALVVSRGVIPEDSDAEKEFQRQWDTLRS
QMGHIQQTEFVRVTAGADNALRAVEVETAFDRNGQAVWQRQLAARVPDSNILMIFTLSAM
RAFNEADGQRWSAFKQSLSLNNPRKA
Download sequence
Identical sequences A0A176UY41
WP_063880035.1.60514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]