SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A176VHT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A176VHT1
Domain Number 1 Region: 66-276
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 4.71e-57
Family Chlorophyll a-b binding protein 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A176VHT1
Sequence length 279
Comment (tr|A0A176VHT1|A0A176VHT1_MARPO) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=1480154 OS=Marchantia polymorpha subsp. ruderalis. GN=AXG93_948s1250 OC=Marchantia.
Sequence
MATTVACRAVAGAVFAPAQEQRLMGGNALRVSFAPIGTSNARSSIVVRASSDKPVKANRQ
LIFASEQSLSYLDGSLPGDYGFDPLGLSDPQGAGGFIDPNWLRYAEIINGRFAMLGAAGA
IAPEIFGKIGLIPQETAIPWFQTGVIPPLGQYSYWADPYTLFVLEMALMGFAEHRRAQDY
YKPGSMGKQYFLGFEKVLGGSGDPAYPGGPLFNFLGFGRDEKSMKDLKVKEVKNGRLAML
AVLGYFIQAIFTGVGPFQNLLDHLSDPANNNVLTNLKIH
Download sequence
Identical sequences A0A176VHT1 I7KJM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]