SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177A662 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177A662
Domain Number 1 Region: 8-158
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 4.71e-39
Family Thiamin pyrophosphokinase, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 168-251
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 5.49e-25
Family Thiamin pyrophosphokinase, substrate-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177A662
Sequence length 256
Comment (tr|A0A177A662|A0A177A662_9PEZI) Thiamine pyrophosphokinase {ECO:0000256|PIRNR:PIRNR031057} KW=Complete proteome OX=655981 OS=Pseudogymnoascus destructans. GN=VC83_06758 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MKWDPARLISHDHGYEGYALLTLNQPLDNLDLLRSLWERAGYRIAADGGANRLHKVFHGD
STFENLMKKIPLEVIHGDLDSLHQTTRSWALAHSMEVVLDPSQDSTDFTKCVSYISKHCL
PKCDSAPDIIVLGGLGGRVDQGLSILHHLYKGPQIYPHGRIYLVSTSAITFLLTAGTHQI
VVKNPEARVLGKNIGILPVGVPAKITTKGLKWDVEDWETSFGGQVSTSNMVREAEVTVTT
NADVLFTIDLDMGGEE
Download sequence
Identical sequences A0A177A662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]