SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177CEF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177CEF9
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000615
Family Hevein-like agglutinin (lectin) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177CEF9
Sequence length 55
Comment (tr|A0A177CEF9|A0A177CEF9_9PLEO) Uncharacterized protein {ECO:0000313|EMBL:OAG06015.1} KW=Complete proteome; Reference proteome OX=1460663 OS=Paraphaeosphaeria sporulosa. GN=CC84DRAFT_1069928 OC=Didymosphaeriaceae; Paraphaeosphaeria.
Sequence
SKPVSRDSRCGQDHKHQTCQGSAWGNCCSKYGYCGSTKDYCGAPSCQKEFGSCNG
Download sequence
Identical sequences A0A177CEF9
XP_018036380.1.78146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]