SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177D4K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177D4K3
Domain Number 1 Region: 808-841,878-935
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000196
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177D4K3
Sequence length 981
Comment (tr|A0A177D4K3|A0A177D4K3_ALTAL) Uncharacterized protein {ECO:0000313|EMBL:OAG14070.1} KW=Complete proteome; Reference proteome OX=5599 OS=Alternaria alternata (Alternaria rot fungus) (Torula alternata). GN=CC77DRAFT_579732 OC=Pleosporaceae; Alternaria; Alternaria alternata group.
Sequence
MALSLFTADPLKPEIRLAQAVSQFEANLTKPQKIAFRIQRTQALQSPPSTMDVMRITAEI
DISQKAGGRCFGPRFTTFLHGVQQFAALGDVIVGSSQNIVAAGVWSVIRTSLLATTNRSL
YLESLSLLLMEAGHSTQHHSDLALLYPCSRSLQDYITEYFIVVVQICLHFQLYTQKSALG
KFASSLNDAYLKEARSSLLAWSRSIQAQVGALVARRVETEAESNSRFRAVISASAKNAGH
QQKRAAIQKLLDCCSTYDYETPWRQIRKAGNTSLYTHLPEYSQWVVAPESRTLILVGKLG
YGKSVTLANIVDNLILQIDPKTSGLVHFFCRHDLPESLSARTALGALIRQIISLFSQSLD
GSDDIEHYEFSRFYSLMRGIVPPKYVIYIVLDGLDLCPLPERKIIVEQLEHMKTHLNIRL
CVSRRLEPEAELHPISAEFSQAMVVELPDNSSDIESYIETQLEKALSNHSLTLGDPMIVL
EIRDALLRGSQGMFLWVALQIQSICIMQTDHEIRRALANLPKDLSEIYSRILQNAQKSGP
SLQSDIFKLVIVSRRPLTVNEMREALSVSPGDINWDPTKLLNNAYSALAMCGCLITIDEE
EHTIRTIHPSINQFLLHDGLKPLTSPGELRFTLDDANSFISSIIVTYLSYGLFGTELAIH
IPTLNMGSAPSHIINSTTGKVRTIQNIAVKLLRSRKQLDFDISKVFAQDQSVHRPLSTGD
FYFQHYAKRYALKHLADFPVLSCNTSAAFFRLFKQGTLCVRTKAEAMGLLWLWLQPPGTI
DVRDLFVHISEEAASSLSLEWQQCPGQLFSRAIRTGRLHAIRYLLELYPPVLKPFHNDET
GPIMPALRDVSVLESMSLVDGSLRYPLRPYDERRRLFLGRAPLRLAIESSQTGSLEMLAS
SELIDRNDEERHMRSLLSVAIEKRNVNAVKILLSSKRVCPTEEEKYNARERLYREIRAKR
GWSCKWDDIPVDSAMEIYNLL
Download sequence
Identical sequences A0A177D4K3
XP_018379491.1.3594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]