SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177LUP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177LUP0
Domain Number 1 Region: 121-215
Classification Level Classification E-value
Superfamily LCCL domain 4.97e-23
Family LCCL domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A177LUP0
Sequence length 220
Comment (tr|A0A177LUP0|A0A177LUP0_METMH) Uncharacterized protein {ECO:0000313|EMBL:OAH96662.1} KW=Complete proteome OX=421 OS=Methylomonas methanica. GN=A1353_03255 OC=Methylococcaceae; Methylomonas.
Sequence
MDEIVKTLFSAPLATVFVIAGLIFLLVAVVGNISGKIEPGPKGRLFSGILGLAFVVVGLA
MHFAQNSAQPSTTPNSPPALSKPAEQIAVVPRAPHSLPVNTPANQAPATLNLPANAEIIE
AGCSFSAAQIEGEPGSSHVVACPAECDAAYQILNGTDTYTSNSFICLAAIHAGLIGPQGG
TVQVIIEKGRPAYRGSIRHKIQSSDYGKYDGSFRLAPPTQ
Download sequence
Identical sequences A0A177LUP0
WP_064038857.1.22977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]