SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177UB11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177UB11
Domain Number 1 Region: 57-150
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.27e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.00000512
Further Details:      
 
Domain Number 2 Region: 147-233
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.15e-30
Family TATA-box binding protein (TBP), C-terminal domain 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177UB11
Sequence length 234
Comment (tr|A0A177UB11|A0A177UB11_9BASI) Uncharacterized protein {ECO:0000313|EMBL:OAJ12455.1} KW=Complete proteome OX=13290 OS=Tilletia caries (wheat bunt fungus). GN=A4X03_g6733 OC=Exobasidiomycetes; Tilletiales; Tilletiaceae; Tilletia.
Sequence
MMNTSRGGALALPSSNSSPSYGAAAASKGKEREGTVAASTGSTTAAAPLPETPAHGIVPT
LQNIVATVNLDVRLDLKTIALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGA
KSEDDSRLASRKYARIIQKVGFEAKFTEFKIQNIVGSCDVKFPIRLEGLAYSHGVFSSYE
PELFPGLIYRMVKPKVVLLIFVSGKIVLTGAKERAEIYEAFNRIYPTLSEFRKP
Download sequence
Identical sequences A0A177UB11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]