SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177WG87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A177WG87
Domain Number - Region: 57-80
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00785
Family Mitotic arrest deficient-like 1, Mad1 0.023
Further Details:      
 
Domain Number - Region: 12-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0139
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177WG87
Sequence length 99
Comment (tr|A0A177WG87|A0A177WG87_BATDE) Uncharacterized protein {ECO:0000313|EMBL:OAJ39073.1} KW=Complete proteome; Reference proteome OX=403673 OS=Batrachochytrium dendrobatidis JEL423. GN=BDEG_22947 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MNTYQAVDQKKEDFRKYLERNGIIDALTKVLVGLYEEPEKPDSPVDYIKQFLSGPSDTDT
EALRHENEELRRRVDELQSRLDEMSATPAPTDPTATIAE
Download sequence
Identical sequences A0A177WG87
BDET_02979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]