SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177WSI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A177WSI8
Domain Number - Region: 49-97
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.068
Family FAD-dependent thiol oxidase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A177WSI8
Sequence length 108
Comment (tr|A0A177WSI8|A0A177WSI8_BATDE) Uncharacterized protein {ECO:0000313|EMBL:OAJ43079.1} KW=Complete proteome; Reference proteome OX=403673 OS=Batrachochytrium dendrobatidis JEL423. GN=BDEG_26464 OC=Rhizophydiales incertae sedis; Batrachochytrium.
Sequence
MRLEMSQDLIGCKVAAEISHLNSVYGIVTNYMQLNFLHSLDEKIGLDEHTCQSCSVYNES
HMDTYGHQCNNQESIVIYKSELTTNNRTNGPTDQCQNTCTSDSLLDMT
Download sequence
Identical sequences A0A177WSI8
BDET_06501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]