SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A177XJ13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A177XJ13
Domain Number 1 Region: 7-53
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000000123
Family BAS1536-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A177XJ13
Sequence length 55
Comment (tr|A0A177XJ13|A0A177XJ13_9BACL) Sporulation protein Spo0E {ECO:0000313|EMBL:OAJ73369.1} KW=Complete proteome OX=1247872 OS=Brevibacillus sp. SKDU10. GN=AYJ08_00940 OC=Brevibacillus.
Sequence
MENTQSKDDLQKLIEILRKELAQLYFKKGSLVHPAVLQLSQQLDEYIVMFEKLRY
Download sequence
Identical sequences A0A177XJ13
WP_064018586.1.28821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]