SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178BP22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178BP22
Domain Number 1 Region: 71-99,138-220
Classification Level Classification E-value
Superfamily GINS helical bundle-like 7.85e-26
Family PSF2 C-terminal domain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 10-69
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000000000719
Family PSF2 N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178BP22
Sequence length 251
Comment (tr|A0A178BP22|A0A178BP22_9EURO) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} KW=Complete proteome OX=979981 OS=Fonsecaea multimorphosa. GN=AYO22_10303 OC=Fonsecaea.
Sequence
MSAFPHPPGLSPAEVAFLCEMESVTIIPRQRLERLDLLGGPTRALIPPQRTTLPLWLAVL
LKRQRRANIMPPPWILAENLQDILETETHKDFEGTFSPSSASLPPQGRRQTDYSGKAFIA
STPFVESCTVDSHATTLPYHWFELSEILLEAASDDIPEPDRVRQLLRDIREVRLAKMRKQ
LPHLSGDGEGTRLDGIGAMELSESRGFVTGVVDGLRKIDASREQERREREREARENQRYN
DDDDDEDDEMT
Download sequence
Identical sequences A0A178BP22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]