SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178DNW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178DNW9
Domain Number 1 Region: 319-440
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-29
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 180-317
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.22e-27
Family cAMP-binding domain 0.000026
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178DNW9
Sequence length 461
Comment (tr|A0A178DNW9|A0A178DNW9_9PLEO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=765867 OS=Pyrenochaeta sp. DS3sAY3a. GN=IQ07DRAFT_591367 OC=Cucurbitariaceae; Pyrenochaeta.
Sequence
MSLPPDYSNEIAALDREILKHRPNDILQFCANFFNRRLESQRTEALLSQHHSSSQGRAEN
SFPGNNPFSTSPSGASFTKSPMQRLEEEEENDVMTSPTASSFAAVDFGKPRAPHNNDAGE
SAFGNFQGFGGSSKNNITQMPPLPADGQNFPSNYNTNRRTSVSAESLNPAHSANDNFTAP
VHPKTPDQLNRLKVAVSGNFLFSHLDDDQSSQVLDALYEKPIPAKDIKVIQQGDVGDYFY
VVEKGSFDIYVNKSGKLESGQDGLGERVGSVGPGGSFGELALMYNAPRAATVVSTDSSTL
WALDRITFRRILMDSAFQRRRMYEGFLEEVPLLSSLTPYERSKIADALETKKYPPGTTII
QEGDVGESFFLLEAGEAQVFKRGIDAPVNQYHKGHYFGELALLNDAPRAASVISKTEVKV
ATLGKNGFQRLLGPVEGIMRRNDPSKAGFAGDHVDPLSKAA
Download sequence
Identical sequences A0A178DNW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]