SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178EZ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178EZ65
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 1.7e-26
Family RNA polymerase subunit RPB10 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178EZ65
Sequence length 76
Comment (tr|A0A178EZ65|A0A178EZ65_TRIRU) DNA-directed RNA polymerases N/8 kDa subunit superfamily protein {ECO:0000313|EMBL:OAL65432.1} OX=5551 OS=Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum). GN=A7C99_2528 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MIIPVRCFSCGKVVGDLWERYLRLLDEGVPDGGSDAMDQLGCKRYCCRRMLMTHVDLIEK
LLRYNPAERDRAKINL
Download sequence
Identical sequences A0A178EZ65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]