SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178F4P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178F4P6
Domain Number 1 Region: 650-762
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000353
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A178F4P6
Sequence length 791
Comment (tr|A0A178F4P6|A0A178F4P6_TRIRU) Uncharacterized protein {ECO:0000313|EMBL:OAL67128.1} OX=5551 OS=Trichophyton rubrum (Athlete's foot fungus) (Epidermophyton rubrum). GN=A7C99_1543 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MVGSWWDEFSNNLATDLAPLIALFGEAPTKQYLSECLTKTDIFIFSMAPLGIITTIVSAI
RVCGTPSLRAFIGRAQEGAGNAEAELCSSTSREDCELYNNGGIARVFGRPKLLEIVHDQN
ATIEDLFQKTSDSQATVGIYLFKDYIKKGSKYWFTAAAIFGGLLQLSVLVWATIARYKFN
DVKRDLQDNYAIPLVVIVPRTQGMSFVRRSGPTRGDDTDECDETWKSYVKCAPYRWRAAV
QSKQSAAKSLPVEGCVRSFMYRARLARLTDSWEDKLVSVRSTAQILAKAIESTMRVFLTS
DTDFEKGWDSAFTLLWVVHSTLEGTDTTSGNIYLSLNREIDKDGQPSGKWHVDESELEAV
LGLWLWSLRGMRNKLQISLRRIISPIPDSTIDIYTTTDFYLWRENGSFKIDERKIKLKQQ
TGLLFGRHNIPVRDCTNFSVLEVAADATSLEMMCAQEIYALFFSSITHTIKNLGGKTEFQ
KSKGLKYVNANVAKLLGSFTESGLGSAVDAFTCVIPAQQSQIGSNSEEGPVKGTEYLNHY
SLLVVSLCECYRKALYCEEIEFSLGGITKILRQSSLSQQKQISLFGTNCWYNERNSANYR
DKEWFKRRSRYTLADAVHCYAKAFIRIARFQACYNPEPFEEKVINLQKALIDRDAISKPD
YLLENLLDRERIRGEYLGDTLLQETRKGNLEYTLFLLNEVSSLSDGLSGGETLVMAAQQG
WYPVVKSLIEHRASLEWKGETCRNAVSYAAENGDINSLNYLFWRREHFQMLRTHLGAVPY
FTLQVMDILTS
Download sequence
Identical sequences A0A178F4P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]