SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A178UAX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178UAX9
Domain Number 1 Region: 18-150
Classification Level Classification E-value
Superfamily GINS helical bundle-like 3.4e-41
Family SLD5 N-terminal domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 167-220
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000000000641
Family SLD5 C-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178UAX9
Sequence length 220
Comment (tr|A0A178UAX9|A0A178UAX9_ARATH) DNA replication complex GINS protein SLD5 {ECO:0000256|PIRNR:PIRNR007764} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At5g47720 OC=Arabidopsis.
Sequence
MASNSEAGGSADYETLMSTSDVELLKRAWRNEKAAPEILQYEGALVDRAKEQIELVEETI
EDYVENGIDPLVVSLYQMDLDRAQFLLRSYLRVRLLKIEKFMFHNLNSEEAERRLSEQEK
VFATRCADDLAKHFEETVLLKLPENYQSVLKQSLISEVDDMVPQPHLDTFVVCRSKNFVS
LNLYEEGESPETVEMERGDLYFIRYKIVKRAIESGQIDLI
Download sequence
Identical sequences A0A178UAX9 Q6NQP5
AR3020 GO.31743 AT5G49010.1 3702.AT5G49010.1-P NP_199712.2.80155 AT5G49010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]