SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A179HPQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A179HPQ1
Domain Number 1 Region: 28-191
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.31e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0005
Further Details:      
 
Domain Number 2 Region: 388-527
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000051
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A179HPQ1
Sequence length 590
Comment (tr|A0A179HPQ1|A0A179HPQ1_9HYPO) Phosphopantothenoylcysteine decarboxylase {ECO:0000313|EMBL:OAQ92317.1} KW=Complete proteome; Reference proteome OX=33203 OS=Purpureocillium lilacinum. GN=VFPFJ_04057 OC=Purpureocillium.
Sequence
MANYPSFPSRLTSTVSSCSSLTDMNTRHRKLHLLVAATGPRDTSWAQALVVRLSKNTQIE
TRAIVDDVVPRLTQTIIVMENRTLAPGQGDRADDIEFYRQQAYELVEWADLMVCVPLDAD
GIAKLLAGIADTFLGEVLRGWNPQKSVVLVPGMSTHMWSNPMTKRHLSKLYRKWNWIRVM
TPILWHYEGAPNPKRVPNWNGFNEVLGIIKNQADLLGLGRDVEIATSAPLLSDSDVKIQV
KLPPEIWTIVLDYAGDWELAKALGMYTNLPMPQPWCLEPKDPTDPLKVYEHELEWTVLTC
SSAAVCKKLSQSPPNFQDIPALVVKLVIRFALIEVLEYMENNRPDLFKAFDGTTLPSNAS
AYYPRTDVLDYWKQSRWFRDKHIYDAEAVDGASKNGHVRILDWWWRRSGLPLRYTETALE
QASGRGHLLVLEWWRDAAAQDESIVLRPGRSLLWATQHGQADVLRWWDASGIPVAHGDSV
AKVASRWGRVNVLETWRRLKGDNKLVFDPEVLISSTIHQHVEVLEWWRKFAHGELEGMDG
RKQLVEFRTCNIEEALEDSIGDQSKARKWWAQYGLDLRMRNEEWLQTRYL
Download sequence
Identical sequences A0A179HPQ1
XP_018181036.1.47811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]