SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A181CEB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A181CEB5
Domain Number - Region: 23-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.00149
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A181CEB5
Sequence length 164
Comment (tr|A0A181CEB5|A0A181CEB5_9PROT) F-type ATPase subunit b {ECO:0000256|HAMAP-Rule:MF_01398} OX=215221 OS=Komagataeibacter rhaeticus. GN=KRIGEM_02879 OC=Acetobacteraceae; Komagataeibacter.
Sequence
MFHDPRFWSAVAFVLFFVLFGRSLWKPLVSALDGRAERIRAELDEAARLRREAEQMLEDA
TRDREAALAEARELVEHSLREAANIAAQARKDAEDAAARREQMAKDRIASAERSALREVR
ETAVDIAIQATRETLAAKLQADDDGKIVDRSIGDLSAALSQRAA
Download sequence
Identical sequences A0A181CEB5 A0A2D3HHS9 F3S5H3
WP_007397272.1.3752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]