SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182FKS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182FKS0
Domain Number 1 Region: 120-268
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 2.48e-17
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily SET domain 0.00000000036
Family RuBisCo LSMT catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182FKS0
Sequence length 271
Comment (tr|A0A182FKS0|A0A182FKS0_ANOAL) Uncharacterized protein {ECO:0000313|VectorBase:AALB007128-PA} KW=Complete proteome; Reference proteome OX=7167 OS=Anopheles albimanus (New world malaria mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MLVCWAVSTVMTRQNKVPVNLSTFEELDFTLALIPLWDMANHITPEQRDGQRHNGTPLVT
DTAYCSKLEKLESILQADCTRAGEPVFINYGKRTDAEFLVHNGFSFAKNPNTRITKLFAL
NRTDSLYKKRARLLELLGVPTVGKMEFGYGEHDSGELSPHLYALSRVSVLTEDELDYYID
TVDDPLKRAELCQRRFELPTAAIPSADDLRQRQRQWLASAMETILRRYPTTVAQDEALLH
ENLPHRLHHLRRLLIEFRLHEKRVLHSFIED
Download sequence
Identical sequences A0A182FKS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]