SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182GX10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182GX10
Domain Number 1 Region: 30-91
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000249
Family ATI-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182GX10
Sequence length 91
Comment (tr|A0A182GX10|A0A182GX10_AEDAL) Uncharacterized protein {ECO:0000313|VectorBase:AALF017355-PA} KW=Complete proteome; Reference proteome OX=7160 OS=Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta). GN= OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MRFVASSPALLGVALIIVLTIVVVVAQPAKQCPSREIYNECGTACPATCDSIKRNDGPKI
CTANCVIGCFCDRGYVRNTNSGRCVVAEDCP
Download sequence
Identical sequences A0A182GX10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]