SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182HSR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182HSR9
Domain Number 1 Region: 15-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0023
Further Details:      
 
Domain Number 2 Region: 331-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000242
Family Motor proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182HSR9
Sequence length 388
Comment (tr|A0A182HSR9|A0A182HSR9_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA004324-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MNYLLHCQRSPGAVIPIPPELEELMQDISREVLRSQPPNVITFLADYLEEKLARRENRRV
AEKIVDNVLDISLDIVAMLEAVGIDSTRAEEAVKRIREAFHHHFETRPDNERLRETFRER
DVLERLVRECHFTEQEARKASRIIEQAYRTYYFRNAYKEQHQAAGTDKDWRQAAKHTLGL
YAQTGPTREEMEVAARRIQVAYRAYYTRRRQELDRSAKIIQQAVRTHQRRRLEEAAVAGV
PSVLIAQEIVGEPVGEQYTPSEDIRHLINVSLGCSEDVPEQQMRRQPTPPELTTDEAATM
IQSVFRGHQARKQIVPNAAAADAPSQLDPDQAATLLQSTVRGHLARKHAGKEKVKHQMAT
MLQSHARGHLARKRLPRNGPPDTTNPME
Download sequence
Identical sequences A0A182HSR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]