SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182HWR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182HWR9
Domain Number 1 Region: 1196-1262,1604-1649,1696-1815
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-28
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 3033-3098,3224-3244,3397-3575
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.02e-21
Family Ankyrin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 2772-2815,2929-3087
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000572
Family Ankyrin repeat 0.0062
Further Details:      
 
Domain Number 4 Region: 1217-1299,1423-1460
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000131
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182HWR9
Sequence length 3712
Comment (tr|A0A182HWR9|A0A182HWR9_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA005748-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MCIKETRTDPSCISALFEAISSKDETMLKNALRMATIETVLCFESTYGVSPLIWCVQTGD
VSYLGLVECLLSTGLYDCQMVDSKGRPVLASIAEKHTDNPKFVEKLIELEIQGVDEVTAC
YRILRQNSLQLLKLYIALKKLDGAALFQSLANALIQLEVKNFPLSSELKIYVQWKLADYG
HRHLSGDYNPPPGQTTHHEWKSHIKVISDCWSVIAEKYDTGDYVDIDDRLLQRLTVIHNH
LYFLQYKPFVKHLPMIELIFCLALFLRSFKVDSVVYRMLVNKRLILQFLRMIVRQLNYIK
RSLLDIETKLKGIVQDHDQSLDVLKRDAIIESISEELETMAVPNKSYVVDQFCEKMAAVI
YKTGTLLDQPCENDLIVDFLKHIKKSNKQWAQQKIDEINYLKQESKDRLIALVKSRIPCT
THPVNVADRLIKLMKGKTSLAQIVADESFSMEHLMSKQDRRTVRRMIKCYNKTKQYYSLT
KIYGSLSQVGELNHKNGAVFVPCIKRAFTVLGETMKNTKSTPNMPHGRIRNTVEKLLMPQ
LSAFNISHRNTYAKAFSLKRLLIADNLEENILINLPLYMTVVRVMLLLLIAVLGADIRRS
FYGMLYECNTVQALRSLLLYVENDDDFAKMLKECLKEVKKYFDNIEKLLKELEHSPVGQK
AQFENVKQHFTQQYTLSKELRTMLETEEAISNLRKTCFACTDIITIRRLLRWKLESHHPN
RLLQRMSKEWDTSTTEINSMVNLDTRLVTINIATVPNKLKMIQMAMDSAYYYGCIEHTRQ
LAKQIGIDATDDSKHQTLNTKLRSYYDNMFFLDNKWKSINEFCKQNHILLPSDKVNSLRE
EDEARLQQLFEERQNRLRTILEIGNIREVEDIASCLKTISPCIIAALEYIQLEVCEILTT
VGYFGDNFYYLKHRIPMIMGKSYRNLLAHDALSYDMLSDSGEEKLLINAIVLANTKITLF
PTANNKPQCRNTIELSFPTPENTFRWVEKQEKIIEVLKADDSQLLQVMMQAGGEIKSHFY
YELQPDQHQPSHLDLTKIVHRFCRPNSTVIQLLGRYFPSFAKTYHHPEIMLQNALERSDF
HQVIELYCSLPEMEFDKRVFSWPMLLSKFSSDFIARLPLQRKQEYLNLFLDYGNESCARK
MISNHIQNPSQHTVSHAMIRGMYSVVELLVQNTSRLQTNDMELAIIMHWNDLLPAIAVKI
ELDAKEYVTLIETAVKVNNEKAVEYLLHDKLKRTEKALKVCIVTAALHGRNNILKYLLSH
FFTPASILLEALREAAATKHWITTRLLLEAVGSEELECPSDARMTDILLGFVTLGQSRLI
RKIGSLYKFNYESIKYHPLALAVEYRKATPRMIASLRLLSFGWLDCTSILHEIILQGSDE
PSWNAIWSNIDDHLSKIFTLNSDHCTLAINVLQRWKTIAFVEQIKSSNTSLCCAIQSNDI
SILRTLLSRSRDMRNLNNTSILQEIVFQIGSLIVRLDTEHGQWDVRTCCDKMINRMTHLF
ASSNETCWQEFTIVCGEVVVHFSVFASEEISQPIEVEFNIRNNTRFIDNLQDVQIIANEV
FNKHTVVHATFTKGNRTVHFWRLEDWTCAYDIYPPNSAIDLLPLVNIPALFRKTVLHCAA
LKETDVETLKLLMENGAHPLLKDKFGKTPVHHALQNPLKPELALCLMRECVERCLCSVDG
SSLIEVTDGDGKNKLIHTATIWGHEDAILYLLRNNADVTARNVHLQTPAHIVAVKPMYNS
VALMKILLDQDRGLLNLVDSYGCTPLGWAAKVGNIKLLHTIMEYRPDFDNTSANRDALKY
ALMAHHAQWVKCFIEFLTANGIQGITKLLDMDLIILSLDVDDWQLSVVLLEYELGHTLTK
QPTRAISSKDETMLADALRMATIETVLCFESTYGVSPLIWCVQTGDVSYLGLVECLLSTG
LYDCQMVDSKGRPKLDGAALFQSLANALIQLEVKNFPLSSELKIYVQWKLADYGHRHLSG
DYNPPPGQTTHHEWKSHIKVISDCWSVIAEKYDTGDYVDIDDRLLQRLKVIHNHLYFLQY
KPFVKHLPMREMIFCLAIFLTIFHHPREYFMFRLIVNKCLVMDFVRTIVRQVECIKENLE
KIEEDLKMITNASDSWTNNSIASFFEILIERLEIANIPNKAYIAKQLHQKRTRPSFTVVV
ELFKTMKKYDKQWATSKIPEMKQLVKECREHLISAIKNHIPSALHPANVADRLIAQMKSN
TLIDTAVTGIVANESFNMEAFMGGKDRRSIRKLRKCYKHGKQFYSLWKINNCFSDMDKAS
LEHPEVIFGSVKRVLTVLGESVKNTNSTPNMPNKWINLMFQKFLTYQFTDCTIFLRNVYA
KQFSLARLSITYDMEREILKEVSEQVVPFLLKLRILFISALAGIRRTFCGMLYRCASLEA
LRSLLQYANIEIDASGEETHWYAEVEYFFNHKTPNPKRPVKHAALFEQVELQLIQQCAII
KEWLAMIQTQNRVPFSSLRQTCFACNDITTIRRLLRWKLESCYPNKMLQRMCNTWNSSTL
ERINISTLFPSLSAIDPDTVSGNLRRIQQAMGSAHYCIDHTRKLTCDFRIANSIDETMLE
ELNTILRPYYDNMFLLDHKWKALQTFCKKHQLPWNIPLAAELRVRDQALLQQLFDNRRKK
LRSLLEIYGIRKVEDIAILIKNDNPLVHASLQYYQQEICEMLTAVGYFGDSFHYLKHRLP
MIIGKSYRNLLAHDNLSYNVLTDGGDEKIVINAFILAHTTHNLFDEMQGDQIEFSFPAIE
DTYEWIDDQHRLLTAVKSDDVERVNEIMQTGGDLRGLFCTSPFHQLERVNYLLKHVHRFC
LPNSAVIKLLGRYFPTFADYNHRPDMMLQRALVRQDYEKVVELFSIKTVVKNECNLESTI
ETLNRVPVNVFAWPMFLSRVLAKTMTAISWLDKQVYLNLFLDYGNESCAREMISSYIKNP
EQSTVSHAMIRGMYSVVELLVQNTSRLQTNDMEHAIIMHWNDLLPAIAVKIELDAKEYVT
LLETAVKVNNEKAVEYLLQDTLKRTAKALKVCIVTAAVHGRDKLLKQLLEDYPIKDCTVL
STALHQAALYCRWRCVRTLLETKAAADVFMSDFKSVDANALLLLVTCDQVQLIGKIESVN
PAVYCTRMQHPFAVAIRYSTDTLRMIASLRLLGFGWLDCTSILHEIILQGSDEPSWNALW
SDIDDQLSKTFTLNSDHCTLAINVLQRWKTIAFVEQIKSSNTSLCCAIQSNNISILRTLL
SRSRDMRNLNNSGILQEVVFQISSSIVRLDTEHDQWDVRTCCDKMINRMTHLFASSNETC
WQEFTIVCGEVVVHFSVFASEEISQPIEVEFNIRNNTRFIDNLQDVQIIANEVFNKHTVV
HATFTKGNRTVHFWRLEDWTCAYDIYPPNSAIDLSPILNVQVLAGQTVMHEAMMWEVDQE
MIQLLVKNGASPLVVDACGDTPINGALRNFPMPEVAIYLIDECLRHDLRDAEGFTLKDAV
YKHQLLVDAAVNGQTIAVKRFLQLNIDLTTAYSDGKTVAHMVACTQLANSVHMMEMLLDY
DSRLIDMVDVNGCTPLAYAAEVGSVAMLNLILKYNPKLEMMPTSRIALRTAICEHQVGWA
KRFLGVLHEKQVRGITSIDGDDEDDDLVVLSLKCNDLQLSKALIEYELGHPVEETTKDNI
PRIQKILQSTTLDEPRVPMQILIEINNLAGAKEFFAILRNISAKITQTADNK
Download sequence
Identical sequences A0A182HWR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]