SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182I116 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182I116
Domain Number 1 Region: 49-127
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000144
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 
Domain Number 2 Region: 189-273
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000576
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182I116
Sequence length 318
Comment (tr|A0A182I116|A0A182I116_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA007255-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVTVALESSVVTAAGLAALLLTLAAVIGTSGNPLECPRPAATGSPPSGWQPRTPEQTLYA
YVRCLNDSSASIEMKIRWVMWRPDQSPESQCYVKCVSEDLRLYDPARRQFVPERFEQQAR
AFHEDPEADDIRTLYTDAQRLLAGELPDSDCSTVFAKYAPFYAVHQEHILDIFHGDLRKI
LVTYQRLGPRVKQIGQSFVDYCEKRYGFAWAEEEQRPCPNQTAVECILRGFRWITEEGNV
NVAEIVRDFDGFGVEASELKQCQGADDLYWCLRSLNADKLAAVIRQRDAQTAYYFDQSST
DEPWKSAVDFGNARLNRA
Download sequence
Identical sequences A0A182I116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]