SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182I283 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182I283
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-40
Family Calponin-homology domain, CH-domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000222
Family EB1 dimerisation domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A182I283
Sequence length 265
Comment (tr|A0A182I283|A0A182I283_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA007680-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MAVNVHFTGQTTENLSRIELLAWVNRTLLSEFKKVEELCTGAAYCQLMDVLFPGCLALRR
VKFCTNVEHDFLNNLRMFQNALNQMKVNKAVPIDRLAKGRFQDNFEFLQWFKKFYDANYD
GKEYDPQMARNNAPMGYGTPSTLRPTQRLNTGSARPVSSGRPVKRAGDMNGSAGRKHAEE
KMGAAGGGVGDAAGAQAAGGEKTNDRISALSAEINELAMQMQNVEMSREYYFNKLVLIEN
YINEQPEDSQDGLCAKVKEIMYAST
Download sequence
Identical sequences A0A182I283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]