SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182I433 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182I433
Domain Number 1 Region: 196-242
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.35e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 246-289
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.49e-17
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A182I433
Sequence length 290
Comment (tr|A0A182I433|A0A182I433_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA008329-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MEQNPPNVVESDKETASATGSELSLGSGSRTHRLLYEQRYREERARLLLELEQLRQGTHP
EYLKVEKRLQDELDDRLQQNEIERDRALAAIERDCLMEHAASEVEYEEKVAELVANAIAD
LEHERKAIEHEYATMELGGCADGGGAMTQTARWKLRSRVNETATPEQHRKPMVRQLKFLL
EEDEIVDDLGEEEQHLRECESYIQTHCIQRLLKDCIVQLCVSRPENPIVFLRQYFQKLER
EEEQHLRECESYIQTHCIQRLLKDCIVQLCVSRPENPIVFLRQYFQKLER
Download sequence
Identical sequences A0A182I433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]