SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182I9U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182I9U0
Domain Number 1 Region: 58-198
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 1.7e-34
Family MOSC N-terminal domain-like 0.0048
Further Details:      
 
Domain Number 2 Region: 54-114,222-337
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000827
Family MOSC (MOCO sulphurase C-terminal) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182I9U0
Sequence length 340
Comment (tr|A0A182I9U0|A0A182I9U0_ANOAR) Uncharacterized protein {ECO:0000313|VectorBase:AARA010350-PA} KW=Complete proteome; Reference proteome OX=7173 OS=Anopheles arabiensis (Mosquito). GN= OC=Culicidae; Anophelinae; Anopheles.
Sequence
MLSKLLNDGAGGKPTAGQLLAVAAGVGVATALGYGVYRLLQYRAAQQPPSEWHRVGEVSD
LWIYPIKSCGAVRVRQFQCSPIGPQVGFLRDRIFMVVKSADGKFITGRSHPTLVLVQPAF
DAQYERMTLSAPGMMDIGVDVRKLLESSAPGSAEVWDQPVTAVDCGEEVARWLSRFLLSE
DFGLRLVYYPLDRPTRPVREKNRIHRLLTARDSGALHDATSYMLVSEGSVADVNTRLDKP
VPALQYRANILVKGPSAFEEDDWRWIRIGDTVYRNVKPCTRCLFTNVDPETGVSSPEQEP
LNTLRKYRLKPGLGQSPVVGMQMGIRTLGAIGLGDAVYVG
Download sequence
Identical sequences A0A182I9U0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]