SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A182JXF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A182JXF5
Domain Number 1 Region: 4-127,162-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-35
Family Nucleotide and nucleoside kinases 0.00000814
Further Details:      
 
Domain Number 2 Region: 127-163
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000000523
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A182JXF5
Sequence length 216
Comment (tr|A0A182JXF5|A0A182JXF5_9DIPT) Adenylate kinase 3 {ECO:0000256|HAMAP-Rule:MF_03169} KW=Complete proteome; Reference proteome OX=43041 OS=Anopheles christyi. GN=Adk3 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MASGKLFRAIIMGAPGSGKGTVSGRIVKSFSLKHISSGDLLRSNIEKRTELGQIADKYIR
EGKLVPDIYITKCILNELEQIQSHSWLLDGFPRTREQADDLWKQERIDSVINLDVPFEVI
IERIQSRWVHLPSGRVYNVGFNDPKTPGRDDVTGEPLSQRPDDNPVAVRKRLEVYDACTR
PINEYFDKKGVLVTFKGSTTDEIWPHVKKYLEAKIQ
Download sequence
Identical sequences A0A182JXF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]